SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012826 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012826
Domain Number 1 Region: 157-226
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000126
Family VWC domain 0.018
Further Details:      
 
Domain Number 2 Region: 284-359
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000209
Family VWC domain 0.018
Further Details:      
 
Domain Number 3 Region: 626-683
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000621
Family BSTI 0.047
Further Details:      
 
Domain Number 4 Region: 99-166
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000241
Family VWC domain 0.006
Further Details:      
 
Domain Number 5 Region: 62-106
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000889
Family VWC domain 0.046
Further Details:      
 
Domain Number 6 Region: 236-289
Classification Level Classification E-value
Superfamily FnI-like domain 0.000046
Family VWC domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012826   Gene: ENSGGOG00000013145   Transcript: ENSGGOT00000013197
Sequence length 685
Comment pep:known_by_projection chromosome:gorGor3.1:7:34517756:34765337:1 gene:ENSGGOG00000013145 transcript:ENSGGOT00000013197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWFSGVGALAERYCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIP
FITDNPCIMCVCLNKEVTCKREKCPVLSRDCALAIKQRGACCEQCKGCTYEGNTYNSSFK
WQSPAEPCVLRQCQEGVVTESGVRCVVHCKNPLEHLGMCCPTCPGCVFEGVQYQEGEEFQ
PEGSKCTKCSCTGGRTQCVREVCPILSCPQHLSHIPPGQCCPKCLGQRKVFDLPFGSCLF
RSDVYDNGSSFLYDNCTACTCRDSTVVCKRKCSHPGGCDQGQEGCCEECLLRVPPEDIKV
CKFGNKIFRDGEMWSSINCTICACVKGRTECRNKQCIPISSCPQGKILNRKGCCPICTEK
PGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKS
VELVLGESRVSLQQHLTVRWNGSRIALPCRAPHFHIDLDGYLLKVTTKAGLEISWDGDSF
VEVMAAPHLKGKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRK
PVPELCQGTVKVKLRAHQECQKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCE
SFLAYTRACQREGIKVHWEPQQNCAATQCKHGAVYDTCGPGCIKTCDNWNEIGPCNKPCV
AGCHCPANLVLHKGRCIKPVLCPQR
Download sequence
Identical sequences G3RBH1
ENSGGOP00000012826 XP_018885843.1.27298 ENSGGOP00000012826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]