SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012835 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012835
Domain Number 1 Region: 141-204
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000367
Family C-type lectin domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012835   Gene: ENSGGOG00000013162   Transcript: ENSGGOT00000013206
Sequence length 216
Comment pep:novel chromosome:gorGor3.1:12:10630685:10641203:-1 gene:ENSGGOG00000013162 transcript:ENSGGOT00000013206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWRLIAVTLGILCLLLLM
IVTVLVTNIFQCIQEKHQQQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNDSFQQ
KKELDSHLIQKNRCHRENEIVFKVLQNTGKFSEDHWSCCGVNCYYFTMQKKDWKGCKQTC
QHCRSSLLKIDDKDELVFYIHFYSLGRCFSMLDLRY
Download sequence
Identical sequences G3RBI0
ENSGGOP00000012835 ENSGGOP00000012835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]