SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012881 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012881
Domain Number 1 Region: 101-387
Classification Level Classification E-value
Superfamily L domain-like 3.91e-44
Family Internalin LRR domain 0.014
Further Details:      
 
Domain Number 2 Region: 406-710
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.29e-42
Family Rhodopsin-like 0.00054
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012881   Gene: ENSGGOG00000013198   Transcript: ENSGGOT00000013252
Sequence length 759
Comment pep:known_by_projection chromosome:gorGor3.1:4:168968222:169054152:1 gene:ENSGGOG00000013198 transcript:ENSGGOT00000013252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSKATMLWLVIIFGRKLSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADED
NCGDNNGWSLQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRA
VPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKITSISIYAFRGLNSLTKLY
LQNNKITSISIYAFRGLNSLNFWLVVLEFGTESRTPPITIFLSTSLLSIVLMNNVLTRLP
DKPLCQHMPRLHWLDLEGNHIHNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLD
ELDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNI
QQRMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAV
TCFGNIFVICMRPYIRSENKLYAMSIISLCCADCLMGIYLFVIGGFDLKFRGEYNKHAQL
WMESTHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCVRPGKCRTITVLILIWIT
GFIVAFIPLSNKEFFKNYYGTNGVCFPLHSEDTESIGAQIYSVAIFLGINLGAFIIIVFS
YGSMFYSVHQSAITATEIRNQVKKEMILAKRFFFIVFTDALCWIPIFVVKFLSLLQVEIP
GTITSWVVIFILPINSALNPILYTLTTRPFKEMIHRFWDNYRQRKSMDSKGQKTYAPSFI
WVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS
Download sequence
Identical sequences ENSGGOP00000012881 ENSGGOP00000021874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]