SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013011 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013011
Domain Number 1 Region: 249-456
Classification Level Classification E-value
Superfamily Kelch motif 8.24e-58
Family Kelch motif 0.0000136
Further Details:      
 
Domain Number 2 Region: 14-132
Classification Level Classification E-value
Superfamily POZ domain 6.67e-39
Family BTB/POZ domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013011   Gene: ENSGGOG00000013338   Transcript: ENSGGOT00000013387
Sequence length 458
Comment pep:known_by_projection chromosome:gorGor3.1:1:47350854:47385129:-1 gene:ENSGGOG00000013338 transcript:ENSGGOT00000013387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANEDCPKAADSPFSSDKHAQLILAQINKMRNGEHFCDVQLQVGQESFKAHRLVLAASSP
YFAALFTGGMKESSKDVVPILGIEAGIFQILLDFIYTGIVNIGVNNVQELIIAADMLQLT
EVVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHSGEEFLALTK
DQLIKILRSEELSIEDEYQVFLAAMQWILKDLGKRRKHVVEVLDPIRFPLLPPQRLLKYI
EGGYTRLQGGRWSDSRALSCVERFDTFSQYWTTVSSLHQARSGLGVTVLGGMVYAIGGEK
DSMIFDCTECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGNTIERFDP
DENKWEVVGNMAVSRYYFGCCEMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMG
TRRAYLGVAALNDCIYSIGGWNETQDALHTVEKYSFEE
Download sequence
Identical sequences ENSGGOP00000013011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]