SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013044 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013044
Domain Number 1 Region: 476-1005
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.3e-152
Family alpha-mannosidase, C-terminal domain 0.00000000000266
Further Details:      
 
Domain Number 2 Region: 52-385
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.45e-123
Family alpha-mannosidase 0.0000000000327
Further Details:      
 
Domain Number 3 Region: 386-493
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.77e-29
Family alpha-mannosidase, domain 2 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013044   Gene: ENSGGOG00000013365   Transcript: ENSGGOT00000013421
Sequence length 1012
Comment pep:novel chromosome:gorGor3.1:19:12890064:12912313:-1 gene:ENSGGOG00000013365 transcript:ENSGGOT00000013421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAYSRASGVCARGCLDSAGPWTMSRALRPPLPPLCFFLLLLLAAPGARAGGYETCPTVQ
PNMLNVHLVPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLSDPTRRFIYV
EIAFFSRWWYQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFL
EDTFGNDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVW
RASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPVVEDPRSPEYNAKELVDYFLNV
ATAQGRYYRTNHIVMTMGSDFQYENANMWFKNLDKLIRLVNAQQAKGSSVHVLYSTPACY
LWELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEALV
GLAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLLSNA
LARLRGFKDHFTFCRQLNISICPLSQTAARFQVIVYNPLGRKVNWMVRLPVSEGVFVVKD
PNGRTVPNDVVIFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRR
SWSPALTIENEHIRATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGDNESDQASGA
YIFRPNQQKPLPVSRWAQIHLVKTPLVQEVHQNFSAWCSQVVRLYPGQQHLELEWSVGPI
PVGDTWGKEVISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVN
TRIYITDGNMQLTVLTDRSQGGSSLRDGSLELMVHRRLLKDDGRGVSEPLMENGSGAWVR
GRHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRDLPPS
VHLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVAN
QLREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTFLASVQWKEVDG
Download sequence
Identical sequences G3RC23
ENSGGOP00000013044 XP_004060128.1.27298 ENSGGOP00000013044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]