SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013101 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013101
Domain Number 1 Region: 45-176
Classification Level Classification E-value
Superfamily POZ domain 3.53e-26
Family BTB/POZ domain 0.00083
Further Details:      
 
Domain Number 2 Region: 394-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-19
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 3 Region: 430-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000136
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013101   Gene: ENSGGOG00000013438   Transcript: ENSGGOT00000013479
Sequence length 573
Comment pep:known_by_projection chromosome:gorGor3.1:1:134000286:134014641:1 gene:ENSGGOG00000013438 transcript:ENSGGOT00000013479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQPGPHPPSPQAAAPGEAWPGPSQAPWQSLEEKMGSPEDDLIGIPFPDHSSELLSCLNE
QRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFKKLFTEGGGGAVMGAGGSGTAAGGAGA
GVCELDFVGPEALGALLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEILQGSGL
EAPSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRK
AFLQTKGARANHLVPEVPTVPAHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEG
PQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNL
APGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLPRHMRTHTGEKPFACEVCGVRFTRN
DKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNHMHLHTGDRPYECHLCHKAFAKEDHLQ
RHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAASPAGLDLSNGHLDTFRLSLARFWEQSA
PTGPPVSTPGPPDDDEEEGAPTTPQAEGAMESS
Download sequence
Identical sequences G3RC78
XP_004026891.1.27298 ENSGGOP00000013101 ENSGGOP00000013101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]