SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013110 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013110
Domain Number 1 Region: 389-417,451-555,677-792
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.99e-54
Family Phosphate binding protein-like 0.0000000965
Further Details:      
 
Domain Number 2 Region: 23-382
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.12e-26
Family L-arabinose binding protein-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013110   Gene: ENSGGOG00000013433   Transcript: ENSGGOT00000013487
Sequence length 1189
Comment pep:known_by_projection chromosome:gorGor3.1:19:45667816:45718162:1 gene:ENSGGOG00000013433 transcript:ENSGGOT00000013487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQKPGGGGSGRGRGGAGGLNVALVFSGPAYAAEAARLGPAVAAAVRSPGLDVRPVALVLN
GSDPRSLVLQLCDLLSGLRVHGVVFEDDSRAPAVAPILDFLSAQTSLPIVAVHGGAALVL
TPKEKGSTFLQLGSSTEQQLQVIFEVLEEYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSL
VGWEHRGALTLDPGAGEAVLSAQLRSVSAQIRLLFCAREEAEPVFRAAEEAGLTGSGYVW
FMVGPQLAGGGGSGAPGEPPLLPGGAPLPAGLFAVRSAGWRDDLARRVAAGVAVVARGAQ
ALLRDYGFLPELGHDCRAQNRTHRGESLHRYFMNITWDNRDYSFNEDGFLVNPSLVVISL
TRDRTWEVVGSWEQQTLRLKYPLWSRYGRFLQPVDDTQHLTVATLEERPFVIVEPADPIS
GTCIRDSVPCRSQLNRTHSPPPDAPRPEKRCCKGFCIDILKRLAHTIGFSYDLYLVTNGK
HGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNGTV
SPSAFLEPYSPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYNRSLATGKRPGGSTFTIGKS
IWLLWALVFNNSVPVENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEEYVDTVSG
LSDRKFQRPQEQYPPLKFGTVPNGSTEKNIRSNYPDMHSYMVRYNQPRVEEALTQLKAGK
LDAFIYDAAVLNYMARKDEGCKLVTIGSGKVFATTGYGIALHKGSRWKRPIDLALLQFLG
DDEIEMLERLWLSGICHNDKIEVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWR
LRHCLGPTHRMDFLLAFSRVWGREGGREGEMAGAGTKVKPSRDKEIPPSCPRTRRASGPA
PFVPRERASVDRWRRTKGMADGFHRYYGPIEPQGLGLGLAQPPQKPPPSYFAIVRDKEPA
ELAFEDESPPLPARWPRSYPETQPLLGSGSYNSPAIALGPREPTPCPYLDLEPSPSDSED
SESLGGASLGGLEPWWFADFPYPYAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAA
WHCRHCASLELLPPPRHLSCSHDGLDGGWWGGWDLPPPAPTSRSLEDLSSCPRAAPARRL
TGPSRHARRCPHAAHWGPPLPTASHRRHRGGDLGTRRGSAHFSSLESEV
Download sequence
Identical sequences ENSGGOP00000013110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]