SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013189 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013189
Domain Number 1 Region: 14-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013189   Gene: ENSGGOG00000013522   Transcript: ENSGGOT00000013569
Sequence length 303
Comment pep:known_by_projection chromosome:gorGor3.1:18:13448480:13885645:1 gene:ENSGGOG00000013522 transcript:ENSGGOT00000013569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFN
SELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQVSTLAAPA
PESGSFQIMHAPRSRDRFTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEPPPY
QGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDIAMYSGGPCPPSSNSGISASTCS
SNGRMEGPPPTYSEVMGHHPGASFLHHQRSNTHRGSRLQFQQNNAESTIVPIKGKDRKPG
NLV
Download sequence
Identical sequences ENSGGOP00000013189 ENSGGOP00000013189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]