SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013200 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013200
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 5.05e-29
Family MHC antigen-recognition domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 84-142
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000714
Family C1 set domains (antibody constant domain-like) 0.0000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013200   Gene: ENSGGOG00000013538   Transcript: ENSGGOT00000013580
Sequence length 189
Comment pep:known_by_projection chromosome:gorGor3.1:6:33706053:33707381:1 gene:ENSGGOG00000013538 transcript:ENSGGOT00000013580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHVASYGVNFYQSHGPSGQYTHESDGDEEFYVDLETKETVWQLPMFSRFISFDPQSALRN
MAVGKHTLEFMMRQSNSTAATNSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEI
YDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSAGLMGIVVGTVFIIQGLHSV
GASRHQGLL
Download sequence
Identical sequences ENSGGOP00000013200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]