SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013215 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013215
Domain Number 1 Region: 161-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000241
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 2 Region: 41-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000467
Family V set domains (antibody variable domain-like) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013215   Gene: ENSGGOG00000013545   Transcript: ENSGGOT00000013595
Sequence length 342
Comment pep:known_by_projection chromosome:gorGor3.1:20:1490908:1507865:-1 gene:ENSGGOG00000013545 transcript:ENSGGOT00000013595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTMSAPTCLAHLPPCFLLLALVLVPSDASGQSSRNDWQVLQPEGPMLVAEGETLLLRC
MVVGSCTDGMIKWVKVSTQDQQEIYNFKRGSFPGVMPMIQRTSEPLNCDYSIYIHNVTRE
HTGTYHCVRFDGLSEHSEMKSDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGDTVFLNC
TVLGDGPPGPIRWFQGAGLSREAIYNFGGISHPKATAVQASNNDFSILLQNVSSEDAGTY
YCVKFQRKPNRQYLSGQGTRLKVKAKSTSSKEAEFTSEPATEMSPTGLLVVFAPVVLGLK
AITLAALLLALATSRRSPGQEDIKTTGPAGAMNTLAWSKGQE
Download sequence
Identical sequences ENSGGOP00000013215 ENSGGOP00000013215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]