SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013243 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013243
Domain Number 1 Region: 513-667
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-46
Family Hemopexin-like domain 0.0000000314
Further Details:      
 
Domain Number 2 Region: 88-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.74e-33
Family Matrix metalloproteases, catalytic domain 0.000000358
Further Details:      
 
Domain Number 3 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 2.31e-21
Family Fibronectin type II module 0.0000869
Further Details:      
 
Domain Number 4 Region: 335-390
Classification Level Classification E-value
Superfamily Kringle-like 4e-21
Family Fibronectin type II module 0.0000911
Further Details:      
 
Domain Number 5 Region: 219-273
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-20
Family Fibronectin type II module 0.0000665
Further Details:      
 
Domain Number 6 Region: 30-104
Classification Level Classification E-value
Superfamily PGBD-like 3.92e-18
Family MMP N-terminal domain 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013243   Gene: ENSGGOG00000013576   Transcript: ENSGGOT00000013624
Sequence length 668
Comment pep:known_by_projection chromosome:gorGor3.1:20:43852375:43857966:1 gene:ENSGGOG00000013576 transcript:ENSGGOT00000013624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWQPLVLVLLVLGCCFAAPRQRQSTFVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIENYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQGGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKRFGFCPTRADSTVMGGNSAGELCIFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVRPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYR
Download sequence
Identical sequences ENSGGOP00000013243 ENSGGOP00000013243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]