SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013270 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013270
Domain Number 1 Region: 294-384
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000627
Family I set domains 0.042
Further Details:      
 
Domain Number 2 Region: 474-565
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000109
Family I set domains 0.032
Further Details:      
 
Domain Number 3 Region: 192-281
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000252
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 381-471
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000768
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 98-186
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000084
Family I set domains 0.0083
Further Details:      
 
Domain Number 6 Region: 20-93
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000112
Family I set domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013270   Gene: ENSGGOG00000013595   Transcript: ENSGGOT00000013651
Sequence length 735
Comment pep:known_by_projection chromosome:gorGor3.1:1:136680058:136704526:-1 gene:ENSGGOG00000013595 transcript:ENSGGOT00000013651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWLLLLILTPGREQSGVAPKAVLLLDPPWSTAFKGEKVALICSSISHSPAQGDTDWYR
DEKLLKIKHDKIQITKPGNYQCKTQGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRC
QGKDNKNTHQKVYYKDGKQLPNSYNLDKITVNSVSRDNSKYHCTAYRKFYIIDIEVTSKP
LNIQVQVELFLHPVLTASSSTPIEGSPMTLTCETQLSPQRPDVQLQFSLFRDSQTLGLGW
SRSPRLQIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRVQRVPVSNVNLEIRPTGGQL
IEGENMVLICSVAQGSGTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKESDAGRYYCA
ADNVHSPILSTWIRVTVRIPVSHPVLTFRAPRAHTVVGDLLELHCESLRGSPPILYRFYH
EDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSHGVSLRVTVPVSRPVLT
LRAPGAQAVVGDLLELHCESLRGSFPILYWFYHENDTLGNSSAHSGGGASFNLSLTTEHS
GNYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGITGLVLSILVLAAAAALLHYARA
RRKPGGLSATGTSSHSPGECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVSPGDSN
PIYSRIWSIQHKKENSANCPMMHQEHEELTVLYSELKNTHPDDSAGEASSRGRAHEEDDE
ENYENVPRVLLASDH
Download sequence
Identical sequences ENSGGOP00000013270 ENSGGOP00000013270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]