SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013296 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013296
Domain Number 1 Region: 9-120
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.77e-39
Family MHC antigen-recognition domain 0.0000191
Further Details:      
 
Domain Number 2 Region: 120-216
Classification Level Classification E-value
Superfamily Immunoglobulin 5.29e-27
Family C1 set domains (antibody constant domain-like) 0.0000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013296   Gene: ENSGGOG00000013630   Transcript: ENSGGOT00000013677
Sequence length 258
Comment pep:known_by_projection chromosome:gorGor3.1:6:34034544:34045692:1 gene:ENSGGOG00000013630 transcript:ENSGGOT00000013677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVLQVSAAPRTVALMALLMVLLTSVVQGRATPENYLYQVRQECYAFNGTQRFLERYIYN
REEWVRFDSDVGEFRAVTEMGRPDAEYWNSQKDLLEEKRAVPDRICRHNYELDEAVTLQR
RVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA
Download sequence
Identical sequences G3RCR2
ENSGGOP00000013296 ENSGGOP00000013296 XP_004043842.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]