SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013300 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013300
Domain Number 1 Region: 231-586
Classification Level Classification E-value
Superfamily L domain-like 1.12e-48
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 6-64
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000408
Family VWC domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013300   Gene: ENSGGOG00000013631   Transcript: ENSGGOT00000013681
Sequence length 605
Comment pep:known_by_projection chromosome:gorGor3.1:9:74404525:74428781:-1 gene:ENSGGOG00000013631 transcript:ENSGGOT00000013681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGKKGHCLVKGITMYNKAVWSPEPCTTCLCSDGRVLCDETMCHPQRCPQTVIPEGECCP
VCSATVSYSLLSGIALNDRNEFSGDSSEQREPTNLLHKQLPPPQVGMDQIVRKEALQSKE
DEEVKEEDTEQKRETPESRNQGQLYSEGDSRGGDRKQRPGEERRLAHQQQRQGSKEDEEV
KEEDTEQKRETPESRNQPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAML
TQIPPLTAPQITSLELTGNSIASIPDEAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKK
LMRLNMDGNNLIQIPSQLPSTLEELKINENNLQAIDEESLSDLNQLVTLELEGNNLSEAN
VNPLAFKPLKSLAYLRLGKNKFRIIPQGLPGSIEELYLENNQIEEITEICFNHTRKINVI
VLRYNKIEENRIAPLAWINQENLESIDLSYNKLYHVPSYLPKSLLHLVLLGNQIERIPGY
VFGHMEPGLEYLYLSFNKLADDGMDRVSFYGAYHSLRELFLDHNDLKSIPPGIQEMKALH
FLRLNNNKIRNILPEEICNAEEDDDSNLEHLHLENNYIKIREIPSYTFSCIRSYSSIVLK
PQNIK
Download sequence
Identical sequences ENSGGOP00000013300 ENSGGOP00000013300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]