SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013361 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013361
Domain Number 1 Region: 119-175
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000017
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.073
Further Details:      
 
Domain Number 2 Region: 34-76
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000733
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013361   Gene: ENSGGOG00000013694   Transcript: ENSGGOT00000013745
Sequence length 696
Comment pep:known_by_projection chromosome:gorGor3.1:17:93811103:93961050:-1 gene:ENSGGOG00000013694 transcript:ENSGGOT00000013745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSRPLAGSAVLEGRLLLESLN
GFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQV
VFGQPPPLETGDDAILGRLLRAQEWGAGTPTEYSAFLTRCFICRVRCLLDSTSGFLTMQF
QGKLKFLFGQKKKAPSGAMLPPQLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAATM
DAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDIGRWAQVPARAPCLCLRGGP
DLVLDPKGGSGDREEEHRMLSRASGVTGQRETPGPTKPLPWTAGKHSEDGARPRLQPSKN
DPPSLRPTPRGSCLPYPCVQGTFRNSPISHPPSPSPSAYSSRTSRPVRDVGEDQVHPPLC
HFPQGSLQHQLPQPGARRFAARGYPMEDVKLQGVPMPPGDLCGPTLLLDVSVKMEKDSGC
EDAADGCVPSQVWLGASDRSHPAAFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPHGRAT
AGRSRELTPFHPAHCACLEPTHGLPQSEPPHQLCARGRGERSCTCRAAEAAPVVKREPLD
SPQWATHSQGVVPGMFPKSALATLVPPQASGCTFLP
Download sequence
Identical sequences ENSGGOP00000013361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]