SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013433 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013433
Domain Number 1 Region: 719-923
Classification Level Classification E-value
Superfamily Fibronectin type III 2.4e-35
Family Fibronectin type III 0.00000777
Further Details:      
 
Domain Number 2 Region: 303-397
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-19
Family I set domains 0.0088
Further Details:      
 
Domain Number 3 Region: 404-517
Classification Level Classification E-value
Superfamily Immunoglobulin 6.53e-18
Family I set domains 0.033
Further Details:      
 
Domain Number 4 Region: 225-310
Classification Level Classification E-value
Superfamily Immunoglobulin 4.88e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 572-673
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000882
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 6 Region: 28-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000128
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 129-199
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000669
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013433   Gene: ENSGGOG00000013767   Transcript: ENSGGOT00000013821
Sequence length 1287
Comment pep:known_by_projection chromosome:gorGor3.1:11:124143721:124244757:-1 gene:ENSGGOG00000013767 transcript:ENSGGOT00000013821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPDLGPLCTLLYVTLIILCSSVSSDLAPYFTSEPLSAVQKLGGPVVLHCSAEPVTTRIS
WLHNGKKLDGNLEHIKIHQGTLTILSLNSSLLGYYQCLANNSIGAIVSGPATVSVAVLGD
FGSSTKHVITAEEKSAGFIGCRVPESNPKAEVRYKIRGKWLKHSTENYLILPSGNLQILN
VSLEDKGSYKCAAYNPVTHQLKVEPIGRKLLVSRPSSDDFHILHPTHSQALAVLSRSPVT
LECVVSGVPAPQVYWLKDGQDIAPGSNWRRLYSHLATDSVDPADSGNYSCMAGNKSGDVK
YVTYMVNVLEHASISKGLQDQIVSLGATVHFTCDVHGNPAPNCTWFHNAQPIHPSARHLT
AGNGLKISGVTVEDVGMYQCIADNGIGFMHSTGRLEIENDGGFKPVIITAPVSAKVADGD
FVTLSCNASGLPVPVIRWYGSHGLITSHPSQVLRSKSQKSQLSRPEGLNLEPVYFVMSQA
GASSLHIQAVTQEHAGKYMCEATNEHGTTQAEASLMVVPFETNTKAETVTLPDAAQNDDR
SKRDGSETGLLSSFPVKVHPSAVESAPEKNASGISVPDAPIILSPPQTHTPDTYNLVWRA
GKDGGLPINAYFVKYRKLDDGVGMLGSWHTVRVPGSENELHLAELEPSSLYEVLMVARSA
AGEGQPAMLTFRTSKEKTASSKNTQASSPPVGIPKYPVVSEAANNNFGVVLTDSSRHSGV
PEAPDRPTISTASETSVYVTWIPRANGGSPITAFKVEYKRMRTSNWLVAAEDIPPSKLSV
EVRSLEPGSTYKFRVIAINHYGESFRSSASRPYQVAGFPNRFSNRPITGPHIAYTEAVSD
TQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSY
DIKMQCFNEGGESEFSNVMICETKVKRVPGASEYPVKDLSTPPNSLGSGGNVGPATSPAR
SSDMLYLIVGCVLGVMVLILMVFIAMCLWKNRQQNTIQKYDPPGYLYQGSDMNGQMVDYT
TLSGASQINGNVHGGFLTNGGLSSGYSHLHHKVPNGVNGIVNGSLNGGLYSGHSNSLTRT
HVDFEHPHHLVNGGGMYTAVPQIDPLECVNCRNCRNNNRCFTKTNSTFSSSPLPVVPVVA
PYPQDGLEMKPLSHVKVPVCLTSTVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSD
GAEDPAEFSRGQEGMINLRIPDHLQLAKSCVWEGDSCAHSETENNIVSWNALILPPVPEG
CAEKTTWSPPGIPLDSPTEVLQQPRET
Download sequence
Identical sequences ENSGGOP00000013433 ENSGGOP00000013433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]