SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013444 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013444
Domain Number 1 Region: 324-419
Classification Level Classification E-value
Superfamily Immunoglobulin 3.43e-27
Family I set domains 0.00031
Further Details:      
 
Domain Number 2 Region: 25-118
Classification Level Classification E-value
Superfamily Immunoglobulin 6.09e-26
Family I set domains 0.0000353
Further Details:      
 
Domain Number 3 Region: 222-318
Classification Level Classification E-value
Superfamily Immunoglobulin 3.48e-25
Family I set domains 0.00044
Further Details:      
 
Domain Number 4 Region: 120-219
Classification Level Classification E-value
Superfamily Immunoglobulin 6.96e-25
Family I set domains 0.00000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013444   Gene: ENSGGOG00000013781   Transcript: ENSGGOT00000013832
Sequence length 486
Comment pep:known_by_projection chromosome:gorGor3.1:19:52051931:52089527:1 gene:ENSGGOG00000013781 transcript:ENSGGOT00000013832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPILTVLICLGLSLGPRTHVQAGILPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHL
YRENKSASWVRRIQEPGKKGQFPIPSITWEHAGRYRCQYHSHNHSSEYSDPLELVVTGAY
SKPTLSALPSPVVTSGGNVTLQCGSQVAFDSFILCKEGEDEHPQRLNSQSHARGWSWAVF
SVGPVSPSRRWSYRCYAYDSSSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPIVAPEESL
TLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHN
LSSEWSAPSDPLDILITGQIHAIPSLSVQPGPTVVSGENVTLLCQSQGGMHTFLLTKEGA
ADVPLRLRSKYQSHKYQAEFPVGPVTSAHAGTYRCYGSLNSNPYLLTHPSEPLELVVSGA
AETLSPPQNKSDSKAGAVNTLSPSQNKTASHPQDYTVENLIRMGIAGLILVVLGILLFEA
QHSQRS
Download sequence
Identical sequences ENSGGOP00000013444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]