SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013445 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013445
Domain Number 1 Region: 315-411
Classification Level Classification E-value
Superfamily Immunoglobulin 4.52e-27
Family I set domains 0.00056
Further Details:      
 
Domain Number 2 Region: 26-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.6e-24
Family I set domains 0.0000557
Further Details:      
 
Domain Number 3 Region: 214-310
Classification Level Classification E-value
Superfamily Immunoglobulin 2.91e-23
Family I set domains 0.0012
Further Details:      
 
Domain Number 4 Region: 117-211
Classification Level Classification E-value
Superfamily Immunoglobulin 1.59e-19
Family I set domains 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013445   Gene: ENSGGOG00000013782   Transcript: ENSGGOT00000013833
Sequence length 444
Comment pep:known_by_projection chromosome:gorGor3.1:19:51725259:51728347:-1 gene:ENSGGOG00000013782 transcript:ENSGGOT00000013833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPILTVLICLGLSLGPRTHVQAGTFPKPTLRAEPDSVITQGSPVTLRCQASLEAQEYHL
YREKKSASWIKRIQPQLVKKGQFPIPSITWEHAGRYCCQYYSHPRWSEPSDPLELVVTAL
PSPVVTSGGNVTLQCVSQLAFGGFTLCKEGEDEHPQCVNSQSHTLGWSWAIFSVSPVNPS
RRWSYRCYGYDSSSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGEILTLQCGSDV
GYDRFVLYKDREGDFLQLPGRQPQAGLSQANFTLSPVRVSHGGQYRCSGAHNLSSEWSAP
SDPLDILIAGQIRARPSVSVQPGPTVASGENVTLLCQSQGWMHTFLLTKEGAADAPLRLS
STYRAQQYQAEFPLSPVTSAHAGTYRCYGSWSSKPYLLTHPSEPLELVVSGPSMVPSPPP
TGPIPTSAGPEDQPLTPTESDPQS
Download sequence
Identical sequences ENSGGOP00000013445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]