SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013482 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013482
Domain Number 1 Region: 375-477,524-542,573-817
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.65e-45
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 1100-1261,1312-1352,1407-1559
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.65e-40
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number 3 Region: 743-999
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.81e-26
Family WD40-repeat 0.007
Further Details:      
 
Domain Number 4 Region: 1521-1605,1657-1746
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.14e-18
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013482   Gene: ENSGGOG00000013796   Transcript: ENSGGOT00000013870
Sequence length 1748
Comment pep:known_by_projection chromosome:gorGor3.1:16:700316:720106:1 gene:ENSGGOG00000013796 transcript:ENSGGOT00000013870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAWQHPFLNVFRHFRVDEWKRSAKQGDVAVVTDKTLKGAVYRIRGSVSAANYIQLPKS
STQSLGLTGRYLYVLFRPLPSKHFVIHLDVSAKDNQVIRVSFSNLFKEFKSTATWLQFPL
VLEARTPQRDPVGLAPSGARWTCLQLDLQDVLLVYLNRCYGHLKSIRLCASLLVRNLYTS
DLCFEPAISGAQWAKLPVTPMPREMAFPVPKGESWHDRYIHIRFPSESLKVPSKPIEKSC
SPPEAVLLGPGPQPLPCPVASSKPVRFSVSPVVQTPSPTASGRAPLAPRPFPEVSLSQEC
SDASNADGPGFHSLEPWARVEASDVHTAAAGTHVLTHESAEVPVARTGSSKGFLPDPVLR
LKGVIGFGGHSTRQALWTPDGAAVVYPCHAVIVVLLVDTGEQRFFLGHTDKVSALALDGS
SSLLASAQARAPSMMRLWDFQTGRCLCLFRSPMHVVCSLSFSDSGALLCGVGKDHHGRTM
VMAWGTGQVGLSGEVVVLAKAHTDFDVQAFRVTFFDETRMASCGQGSVRLWRLRGRALRS
CPVDLGEHHALQFTDLAFKQARDGCPEPSAAMLLVCSRSGHILEIDCQRMVVRHARRLLP
TRTPGGPHPQKQTFSSGPGIAISSLSISPAMCAVGSEDGFLRLWPLDFSSVLLEAEHEGP
VSSVCVSPDGLRVLSATSSGHLGFLDTLSRVYHMLARSHTAPVLALAMEQRRGQLATVSQ
DRTVRIWDLATLQQLYDFTSSEEAPCAVTFHPTRPTFFCGFSSGAVRSFSLEAAEVLVEH
TCHRGAVTGLTATPDGRLLFSSCSRGSLAQYSCADPQWHVLRVAADMVCPDAPASPSALA
VSRDGRLLAFVGPSRYTVTVMGSASLDELLRVDIGTLDLASSRLDSAMAVCFGPAALGHL
LVSTSSNRVVVLDAVSGRIIRELPGVHPEPCPSLTLSEDARFLLIAAGRTIKVWDYATQA
SSGPQVYIGHSEPVQAVAFSPDQQQVLSAGDAVFLWDVLAATESDQSFPGAPPACKTGPD
TGPLEDAVSRASELPRQQVPKPSQASPPRLGVCARPPEGGNGARDTRNSGAPRTTYLASC
KAFTPARVSCSPHSAKGTCLPPASGGWLRLKAVVGYSGNGRANMVWRPDTGFFAYTCGRL
VVVEDLHSGAQQHWSGHSAEISTLALSHSAQVLASASGRSSTTAHCQIRVWDVSGGLCQH
LIFPHSTTVLALAFSPDDRLLVTLGDHDGHTLALWGTATYDLVSSTRLPEPVHGVAFNPW
DAGELTCVGQGTVTFWLLQQRGADISLQVRREPVPEAVGAGELTSLCYGAPPLLYCGTSS
GQVCVWDTRAGRCFLSWEADDGGIGLLLFSGSRLVSGSSTGRLRLWAVGAVSELRCKGSG
ASSVFMEHELVLDGAVVSASFDDSMDMGIVGTTAGTLWFVSWAEGTSTRLISGHRSKVNE
VVFSPGESHCATCSEDGSVRVWALASMELVIQFQVLNQSCLCLAWSPPCCGRPEQQRLAA
GYGDGSLRIFSVSRTAMELKMHPHPVALTTVAFSTDGQTVLSGDKDGLVAVSHPRTGTTF
RVLSDHQGAPISTICVTCKECEDLGVEGTDLWLAASGDQRVSVWASDWLRNRCELVDWLS
FPMPATTETQGHLPPSLAAFCPWDGALLMYVGPGVYKEVIIYNLCQKQVVEKIPLPFFAM
SLSLSPGTHLLAVGFAECMLRLVDCAMGTAQDFAGHDNAVHLCRFTPSARLLFTAARNEI
LVWEVPGR
Download sequence
Identical sequences ENSGGOP00000013482 ENSGGOP00000013482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]