SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013534 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000013534
Domain Number - Region: 645-689
Classification Level Classification E-value
Superfamily RING/U-box 0.0019
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number - Region: 309-379
Classification Level Classification E-value
Superfamily TrmE connector domain 0.0275
Family TrmE connector domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013534   Gene: ENSGGOG00000013871   Transcript: ENSGGOT00000013923
Sequence length 706
Comment pep:known_by_projection chromosome:gorGor3.1:1:134032325:134049331:1 gene:ENSGGOG00000013871 transcript:ENSGGOT00000013923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIKHHQNGTRGQRRKQPHTTVQRLLTWGLPVSCSRFLWRQPGEFPVTALLLGAGAGGLL
AIGLFQLLVNPMNIYEEQKMMFLYSLVGLGAMGWGTSPHIRCASLLLVPKMLGKEGRLFV
LGYALAAIYVGPVANLRHNLNNVIASLGCTVELQINNTRAAWRVSTAPLRAVFKDLLSSK
ELLRAETRNISATFEDLDAQVNSETGYTPEDAMDSGETAQGREARQAAASRLHLSTQKMY
ELKTKLRCSYVVNQAILSCRRWFDRKHEQCMKHIWVPLLTHLLCLPMKFKFFCGIAKVME
VWCRNRIPVEGNFGQTYDSLNQSIRGLDGEFSANIDFKEEKQAGVLGLNTSWERVSTEVR
DYVYRQEARLEWALGLLHVLLSCTFLLVLHASFSYMDSYNHDIRFDNIYISTYFCQIDDR
RKKLGKRTLLPLRKAEEKTVIFPCKPTIQASEMSNVVRELLETLPILLLLVVLCGLDWAL
YSIFDTIRHHSFLQYSFRSSHKLEVKVGGDSMLARLLRKTIGALNTSSETVMESNNMPCL
PQPVGLDARAYWRAAVPIGLLVCLCLLQAFGYRLRRVIAAFYFPKREKKRILFLYNDLLK
KRAAFTKLRRAAILRRAQQQKAPRHPLADILHRGCPLLRRWLRRRCVVCQAPETPESYVC
RTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG
Download sequence
Identical sequences G3RDD3
ENSGGOP00000013534 ENSGGOP00000013534 XP_004026906.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]