SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013590 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013590
Domain Number 1 Region: 360-461
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000267
Family C1 set domains (antibody constant domain-like) 0.075
Further Details:      
 
Domain Number 2 Region: 249-343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000531
Family V set domains (antibody variable domain-like) 0.0018
Further Details:      
 
Domain Number 3 Region: 142-239
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000928
Family C1 set domains (antibody constant domain-like) 0.062
Further Details:      
 
Domain Number 4 Region: 31-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000096
Family V set domains (antibody variable domain-like) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013590   Gene: ENSGGOG00000013930   Transcript: ENSGGOT00000013982
Sequence length 534
Comment pep:known_by_projection chromosome:gorGor3.1:15:53239151:53272202:1 gene:ENSGGOG00000013930 transcript:ENSGGOT00000013982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLRCSFSPEPGFSL
AQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSF
TCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDMVTITCSSYQGYPEAEVFWQD
GQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQ
RSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEG
RDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPY
SKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLF
DVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLAVCLIAL
LVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Download sequence
Identical sequences ENSGGOP00000013590 ENSGGOP00000013590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]