SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013606 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013606
Domain Number 1 Region: 21-186
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.12e-32
Family Dual specificity phosphatase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013606   Gene: ENSGGOG00000013954   Transcript: ENSGGOT00000013998
Sequence length 201
Comment pep:known_by_projection chromosome:gorGor3.1:11:48338338:48346371:1 gene:ENSGGOG00000013954 transcript:ENSGGOT00000013998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLV
QDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALK
YQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLK
EFHKQITAGTTKDGTFDISKT
Download sequence
Identical sequences G3RDJ9
XP_018892095.1.27298 ENSGGOP00000013606 ENSGGOP00000013606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]