SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013805 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013805
Domain Number 1 Region: 36-141
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-23
Family V set domains (antibody variable domain-like) 0.00058
Further Details:      
 
Domain Number 2 Region: 144-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000585
Family I set domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013805   Gene: ENSGGOG00000014153   Transcript: ENSGGOT00000014199
Sequence length 237
Comment pep:known_by_projection chromosome:gorGor3.1:19:38995468:38999885:-1 gene:ENSGGOG00000014153 transcript:ENSGGOT00000014199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPSACPYRVCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNESQ
NLYGYNWYKGERVHANYRIIGYVKNMSQENAPGPAHNGRETIYPNGSLLIQNVTHNDAGI
YTLQVIKENLVNEEVTSQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWW
VNNQSLLVSPRLLLSTDNRTVVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRRE
Download sequence
Identical sequences ENSGGOP00000013805 ENSGGOP00000013805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]