SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013813 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013813
Domain Number 1 Region: 243-523
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.63e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000808
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-28
Family SH2 domain 0.0000108
Further Details:      
 
Domain Number 3 Region: 93-213
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-25
Family SH2 domain 0.0000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013813   Gene: ENSGGOG00000004276   Transcript: ENSGGOT00000014208
Sequence length 595
Comment pep:known_by_projection chromosome:gorGor3.1:12:7152852:7162885:1 gene:ENSGGOG00000004276 transcript:ENSGGOT00000014208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
LETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK
CVPYWPEVGMQRVYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNIT
YPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK
Download sequence
Identical sequences G3QNS0
ENSGGOP00000013813 XP_004052653.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]