SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013869 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013869
Domain Number 1 Region: 221-508
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-59
Family Kelch motif 0.0001
Further Details:      
 
Domain Number 2 Region: 21-75
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000589
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013869   Gene: ENSGGOG00000014214   Transcript: ENSGGOT00000014269
Sequence length 545
Comment pep:known_by_projection chromosome:gorGor3.1:16:71839845:71868473:1 gene:ENSGGOG00000014214 transcript:ENSGGOT00000014269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFLRTKLNYNPPKDDGSTYKIELEGISVMVMREILDYIFSGQIRLNEDTIQDVVQAADLL
LLTDLKTLCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSSTEEFLE
LSPQKLKEVISLEKLNVGNERYVFEAVIRWIAHDTEIRKVHMKDVMSALWVSGLDSSYLR
EQMLNEPLVREIVKECSNIPLSQPQQGEAMLANFKPRGYSECIVTVGGEERVSRKPTAAM
RCMCPLYDPNRQLWIELAPLSMPRINHGVLSAEGFLFVFGGQDENKQTLSSGEKYDPDAN
TWTALPPMNEARHNFGIVEIDGMLYILGGEDGEKELISMECYDIYSKTWTKQPDLTMVRK
IGCYAAMKKKIYAMGGGSYGKLFESVECYDPRTQQWTAICPLKERRFGAVACGVAMELYV
FGGVRSREDAQGSEMVTCKSEFYHDEFKRWIYLNDQNLCIPASSSFVYGAVPIGASIYVI
GDLDTGTNYDYVREFKRSTGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRI
RVHSP
Download sequence
Identical sequences ENSPANP00000011134 ENSGGOP00000013869 ENSGGOP00000013869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]