SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013911 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013911
Domain Number 1 Region: 136-318
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.83e-47
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000182
Further Details:      
 
Domain Number 2 Region: 12-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 3.45e-38
Family DNA repair glycosylase, N-terminal domain 0.000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013911   Gene: ENSGGOG00000014259   Transcript: ENSGGOT00000014312
Sequence length 424
Comment pep:known_by_projection chromosome:gorGor3.1:3:10062082:10080589:1 gene:ENSGGOG00000014259 transcript:ENSGGOT00000014312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARALLPRRMGHRTLASAPALWASIPCPRSELRLDLVLPSGQSFRWREQSPSHWSGVLA
DQVWTLTQTEEQLHCTVYRGGKSQASRPTPDELEAVRKYFQLDVTLAQLYDHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKAL
CILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELG
NFFRSLWGPYAGWAQAGLLGNAFDGHQLLRPLIFCQDHLREGPPIGRGDSQGEELEPQLP
SSLFSIPHGFCDHCWTKDVNDPPLVTHPSPGSRGGHMTQAWPVKVVSPLATVIGHVMQAR
LLAL
Download sequence
Identical sequences G3REC9
ENSGGOP00000013911 ENSGGOP00000013911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]