SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013969 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013969
Domain Number 1 Region: 115-479
Classification Level Classification E-value
Superfamily L domain-like 3.74e-63
Family Internalin LRR domain 0.053
Further Details:      
 
Domain Number 2 Region: 686-781
Classification Level Classification E-value
Superfamily Immunoglobulin 2.29e-24
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 599-697
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 494-601
Classification Level Classification E-value
Superfamily Immunoglobulin 2.17e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 43-130
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000151
Family Ngr ectodomain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013969   Gene: ENSGGOG00000014317   Transcript: ENSGGOT00000014372
Sequence length 1091
Comment pep:known_by_projection chromosome:gorGor3.1:3:67912959:68032952:-1 gene:ENSGGOG00000014317 transcript:ENSGGOT00000014372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPVRGGLGAPRRSPCLLLLWLLLLRLEPATAAAGPRAPCAAACTCAGDSLDCGGRGLA
ALPGDLPSWTRSLNLSYNRLSEIDPAGFEDLPNLQEVYLNNNELTAVPSLGAASSHVVSL
FLQHNKIRSVEGSQLKAYLSLEVLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLEL
GAFDGLSRSLLTLRLSKNRITQLPVRAFKLPRLTQLDLNRNRIRLIEGLTFQGLNSLEVL
KLQRNNISKLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSIARIHR
KGWSFCQKLHELVLSFNNLTRLDEESLAELSSLSVLRLSHNSISHIAEGAFKGLRSLRVL
DLDHNEISGTIEDTSGAFSGLDGLSKLTLFGNKIKSVAKRAFSGLEGLEHLNLGGNAIRS
VQFDAFVKMKNLKELHISSDSFLCDCQLKWLPPWLIGRMLQAFVTATCAHPESLKGQSIF
SVPPESFVCDDFLKPQIITQPETTMAMVGKDIRFTCSAASSSSSPMTFAWKKDNEVLTNA
DMENFVHVHAQDGEVMEYTTILHLRQVTFGHEGRYQCVITNHFGSTYSHKARLIVNVLPS
FTKTPHDITIRTTTMARLECAATGHPNPQIAWQKDGGTDFPAARERRMHVMPDDDVFFIT
DVKIDDAGVYSCTAQNSAGSISANATLTVLETPSLVVPLEDRVVSVGETVALQCKTTGNP
PPRITWFKGDRPLSLTERHHLTPDNQLLVVQNVVAEDAGRYTCEMSNTLGTERAHSQLSV
LPAAGCRKDGTTVGIFTIAVVSSIVLTSLVWVCIIYQTRKKSEEYSVTNTDETIVPPDVP
SYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPNTHSVACRQPKLCAG
YHREPWKAMEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYSRGQAFHPQPVSRDSAQASAP
NGPEPGGSDQEHSPHHQCSRTAAGSCPECQGSLYPSNHDRMLTAVKKKPMASLDGKGDSS
WTLARLYDPDSTELQPASSLTSGSPERAEAQYLLVSNGHLPKACDASPESTPMTGQLPGK
QRVPLLLAPKS
Download sequence
Identical sequences ENSGGOP00000013969 ENSGGOP00000013969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]