SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013987 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013987
Domain Number 1 Region: 33-264
Classification Level Classification E-value
Superfamily L domain-like 8.5e-44
Family Ngr ectodomain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 256-362
Classification Level Classification E-value
Superfamily Immunoglobulin 1.88e-16
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013987   Gene: ENSGGOG00000014343   Transcript: ENSGGOT00000014390
Sequence length 513
Comment pep:known_by_projection chromosome:gorGor3.1:8:144763035:144767697:-1 gene:ENSGGOG00000014343 transcript:ENSGGOT00000014390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRAPALLLLLLLLLPLRAAGCPAACRCYSATVECGALRLRVVPLGIPPGTQTLFLQDN
NIARLEPGALAPLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRGGAFVG
LAQLRVLYLAGNQLARLLDFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRN
QLGTISREALQPLASLQVLRLTENPWRCDCALHWLGAWIKEGGQRLLTSRDRKIMCAEPP
RLALQSLLDVSHSSLICIPPSVHVQPLELTANLGEDLRVACQASGYPQPLVTWRKVPQPR
EGRPRAQAQLEGGLLGLGGQSASDTGSGMLFLSNITLAHAGKYECEASNAGGAARVPFRL
LVNASRQQPQQPAQPPPPAARPAGREPGPEAGSMAFRALGLATQTAIAAAIALLALTALL
LVAMICRRRRRRKKARGPPGEGALFVNDYLDGPCTFAQLEELRDERGHEMFVINRSKPLF
ADGPAEAPADCGPAEGAGPGLRVPPPVAYEIHC
Download sequence
Identical sequences G3REJ9
ENSGGOP00000013987 ENSGGOP00000013987 XP_018887792.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]