SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014104 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014104
Domain Number 1 Region: 66-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000204
Family V set domains (antibody variable domain-like) 0.068
Further Details:      
 
Domain Number 2 Region: 164-262
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000621
Family I set domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014104   Gene: ENSGGOG00000014460   Transcript: ENSGGOT00000014512
Sequence length 273
Comment pep:known_by_projection chromosome:gorGor3.1:8:17291814:17343809:1 gene:ENSGGOG00000014460 transcript:ENSGGOT00000014512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVWLLLGLLLLHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPRIPKIKDRDSANS
APKTQSIMMQVLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVK
QNERYGQLTLVNSTSADTGEFSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSY
FDVVYLNPDRQAVVPCRVTVLSAKVTLHREFPAKEIPANGTDIVYDMKRGFVYLQPHSEH
QGVVYCRAEAGGRSQISVKYQLLYVAGFPSAPP
Download sequence
Identical sequences ENSGGOP00000014104 ENSGGOP00000014104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]