SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014106 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014106
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily vWA-like 2.52e-84
Family Integrin A (or I) domain 0.000000428
Further Details:      
 
Domain Number 2 Region: 621-697
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.42e-18
Family Integrin beta tail domain 0.0027
Further Details:      
 
Domain Number 3 Region: 337-452
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-17
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 4 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000502
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 535-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Integrin beta EGF-like domains 0.00047
Further Details:      
 
Domain Number 6 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Integrin beta EGF-like domains 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014106
Domain Number - Region: 457-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 500-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014106   Gene: ENSGGOG00000014457   Transcript: ENSGGOT00000014514
Sequence length 769
Comment pep:known_by_projection chromosome:gorGor3.1:21:33562374:33599899:-1 gene:ENSGGOG00000014457 transcript:ENSGGOT00000014514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKEIYGQYCECDTIN
CERYNGQVCGGPGRGLCFCGKCHCRPGFDGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSVACPGLQLSNNPVKGR
TCKERDSEGCWVAYTLQQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL
VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Download sequence
Identical sequences G3REV7
XP_004062970.1.27298 ENSGGOP00000014106 ENSGGOP00000014106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]