SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014114 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014114
Domain Number 1 Region: 832-925
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 400-544
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000863
Family Spectrin repeat 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014114
Domain Number - Region: 288-434
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00791
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 123-194
Classification Level Classification E-value
Superfamily Spectrin repeat 0.016
Family Spectrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014114   Gene: ENSGGOG00000014468   Transcript: ENSGGOT00000014522
Sequence length 955
Comment pep:known_by_projection chromosome:gorGor3.1:2b:66868625:66925675:-1 gene:ENSGGOG00000014468 transcript:ENSGGOT00000014522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFQSLKEFYETEIPQKEQDDAKAKHCSDSTEKQWQLFLKKSFITQDLGLEFLNLINMAK
ENEILDVKNEVYLMKNTMENQKAEREELSLLRLAWQLKATESKPGKQQWAAFKEQLKKTS
HNLKLLQEALMPVSALDLGGSLQFILDLRQKWNDMKPQFQQLNDEVQYIMKESQELTGKG
APVKEKSQQLKDLIHFHQKQKERIQDYEDILYKVVQFHQVKEELGRLIRSRELEFVEQPK
ELGDAHDVQIHLRCSQEKQARVDHLHRLALSLGVDIISSVQRPHCSNVSAKNLQQQLELL
EEDSMKWRAKAEEYERTLSRSVEYYAMRDEINELKDSFKDIKKKFNNLKFNYTKKNEKSR
NLKALKYQIQQVDMYAEKMQALKRKMEKVSNKTSDSFLNYPSDKVNVLLEVMKDLQKHVD
DFDKVVTDYKKNLDLTEHFQEVIEECHFWYEDASATVVRVGKYSTECKTKEAVKILHQQF
NKFIAPSVPQQEERIQEATDLAQRLYGLEEGQKYIEKIVTKHKEVLESVTELCESLTELE
EKLKQGDVLKMNPNLEDFHDDYIDLLKEPAKNKQTIFNEERNKGQVQVADLLGINGTGEE
RLPQDLKVSTDKEGGVQGLLLPEDMLSGEEYECVSPDDISLPPLPGSPESPLAPSDMEVE
EPVSSSLSLHISSYGVQAGTSSPGDAQESVLPPPVAFADACNDKRETFSSHFERPYLQFK
AEPPLTSRGFVEKSTALHRISAEHPESMMSEVHERALQQHPQAQGGLLETREKMHADNNF
TKTQDRLHASSDAFSGLRFQSGTSRGYQRQMVPREEIKSTSAKSSVVSLADQAPNFSRLL
SNVTVMEGSPVTLEVEVTGFPEPTLTWYKKGQKLSADGHLQVLHKETRHSVFIPKVCKAD
AGLYVARAQNSSGALSSNVILHVTGNCRLPITRVNWITLCVIYVSVSLMYWLLTQ
Download sequence
Identical sequences ENSGGOP00000014114 ENSGGOP00000014114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]