SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014142 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014142
Domain Number 1 Region: 20-283
Classification Level Classification E-value
Superfamily L domain-like 1.07e-48
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 279-372
Classification Level Classification E-value
Superfamily Immunoglobulin 7.59e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 409-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000118
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014142   Gene: ENSGGOG00000014503   Transcript: ENSGGOT00000014550
Sequence length 635
Comment pep:known_by_projection chromosome:gorGor3.1:11:63754866:63757932:1 gene:ENSGGOG00000014503 transcript:ENSGGOT00000014550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLLXXLLASGAAACPLPCVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFI
QALGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPV
NLQHLILSGNQLGRIAPGAFDDFLESLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNL
IDALPPGAFAQLGQLSRLDLTSNRLATLAPDPLFSRGRDAEASPAPLVLSFSGNPLHCNC
ELLWLRRLARPDDLETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATL
RCRALGDPTPTMHWVGPDDRLVGNSSRARAFPNGTLEIGVTGAGDAGGYTCIATNPAGEA
TARVELRVLALPHGGNTSAEGGRPGPSDIAASARTAAEGEGTLESEPAVQVTEVTATSGL
VSWGPGRPADPVWMFQIQYNSSEDETLIYRIVPASSHHFLLKHLVPGADYDLCLLALSPA
AGPSDLTATRLLGCAHFSTLPASPLCHALQAHVLGGTLTVAVGGVLVAALLVFTVALLVR
GRGAGNGRLPLKLSHVQSQTNGGPSPTPKAHPPRSPPPRPQRSCSLDLGDAGCYGYARRL
GGAWARRSHSVHGGLLGAGCRGVGGSAERLEESVV
Download sequence
Identical sequences G3REZ1
ENSGGOP00000014142 ENSGGOP00000014142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]