SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014158 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014158
Domain Number 1 Region: 349-445
Classification Level Classification E-value
Superfamily Immunoglobulin 2.97e-24
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 248-341
Classification Level Classification E-value
Superfamily Immunoglobulin 4.27e-22
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014158   Gene: ENSGGOG00000014518   Transcript: ENSGGOT00000014566
Sequence length 498
Comment pep:known_by_projection chromosome:gorGor3.1:5:121377772:121399593:1 gene:ENSGGOG00000014518 transcript:ENSGGOT00000014566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNYERPKHFIQSQNPCGSRLQPPGPESSSFSSQTKQSSIIIQPRQCTEQRFSASSTLSS
HITMSSSAFPASPQQPAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNY
QQSSAGQPVNAKPSQTANAKPIPRTPDHEIQGSKEALIQDLERKLKCKDTLLHNGNQRLT
YEEKMARRLLGPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQ
DAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRPVQSDDLHKMIV
SEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKV
LEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGW
YTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPE
GEFQRLAVQSGLYESEEL
Download sequence
Identical sequences ENSGGOP00000014158 ENSGGOP00000014158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]