SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014173 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014173
Domain Number 1 Region: 13-115
Classification Level Classification E-value
Superfamily Immunoglobulin 3.7e-16
Family V set domains (antibody variable domain-like) 0.0036
Further Details:      
 
Domain Number 2 Region: 309-410
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000019
Family V set domains (antibody variable domain-like) 0.01
Further Details:      
 
Domain Number 3 Region: 229-300
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000045
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 121-210
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000903
Family I set domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014173   Gene: ENSGGOG00000014530   Transcript: ENSGGOT00000014583
Sequence length 415
Comment pep:known_by_projection chromosome:gorGor3.1:19:41908037:41913615:1 gene:ENSGGOG00000014530 transcript:ENSGGOT00000014583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SATFLNVAAEISITLEPAQPSEGDNVTLVVHGLSGELLAYSWYAGPTLSVSYLVASYIVS
TGDETPGPAHTGREAVRPDGSLDIQGILPRHSGTYILQTFNRQLQTEVGYGHVQVHEILA
QPTVLANSTALVERRDTLRLMCSSPSPTAEVRWFFNGGALPVALRLGLSPDGRVLARHGI
RREEAGAYQCEVWNPVSVSRSEPINLTVYFGPERVAILQDSTTRTGCTIKVDFNTSLTLW
CVSRSCPEPEYVWTFNGQALKNGQDHLNISSMTAAQEGTYTCIAKNTKTLLSGSASVVVK
LSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWI
AGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKTETLEVELQVAPPIG
Download sequence
Identical sequences ENSGGOP00000014173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]