SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014174 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014174
Domain Number 1 Region: 423-765
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.87e-110
Family PDEase 0.0000012
Further Details:      
 
Domain Number 2 Region: 161-264
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000162
Family Heme-binding PAS domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014174
Domain Number - Region: 34-100
Classification Level Classification E-value
Superfamily CheY-like 0.000211
Family CheY-related 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014174   Gene: ENSGGOG00000014523   Transcript: ENSGGOT00000014584
Sequence length 769
Comment pep:known_by_projection chromosome:gorGor3.1:15:64852683:64928113:1 gene:ENSGGOG00000014523 transcript:ENSGGOT00000014584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKVAVADVQFGPMRFHHDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
LDKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGF
TRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRFIQYA
NPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNI
QQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSL
DVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLE
ILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPIS
LDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRS
WLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH
PGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQG
IIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRTPENRTLIKRM
LIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQDLPVVMPVFDRNTCSIPKSQIS
FIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRSLRPPPE
Download sequence
Identical sequences ENSGGOP00000014174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]