SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014191 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014191
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 4.24e-23
Family BTB/POZ domain 0.0025
Further Details:      
 
Domain Number 2 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000134
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 310-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000435
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014191   Gene: ENSGGOG00000014555   Transcript: ENSGGOT00000014601
Sequence length 424
Comment pep:known_by_projection chromosome:gorGor3.1:9:106227595:106232864:-1 gene:ENSGGOG00000014555 transcript:ENSGGOT00000014601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESDVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYINDTEFQGHKVILAACSTFMRD
QFLLTQSKHVRITILQSAEVGRKLLLSCYTGALEVKRKELLKYLTAASYLQMVHIVEKCT
EALSKYLEIDLSMKNNNQHTDLCQSSDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVKE
EESNALQSTVESLTSERKEMKSPELSTVDIGFKDNEICILHVESISTAGVENGQFSQPCT
SSKASMYFSETQHSLINSTVESRVAEVPGNQDQGLFCENTEGSYGTVSEIQNLEEGYSLR
HQCPRCPRGFLHVENYLRHLKMHKLFLCLQCGKTFTQKKNLNRHIRGHMGIRPFQCTVCL
KTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSGEKLSRPDLKR
QSLL
Download sequence
Identical sequences A0A2I2ZLT4 A0A2I3HRN4 H2QXU8 Q15916
NP_006617.1.87134 NP_006617.1.92137 XP_001139046.1.37143 XP_003264152.1.23891 XP_003833189.1.60992 XP_004048622.1.27298 XP_008956896.1.60992 XP_009455525.1.37143 XP_016817099.1.37143 ENSPTRP00000036464 ENSP00000362763 ENSGGOP00000014191 ENSNLEP00000020902 9598.ENSPTRP00000036464 9606.ENSP00000362763 ENSGGOP00000014191 ENSNLEP00000020902 gi|5730122|ref|NP_006617.1| ENSP00000362763 ENSPTRP00000036464 ENSP00000362763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]