SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014219 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014219
Domain Number 1 Region: 306-487
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-62
Family SPRY domain 0.00000625
Further Details:      
 
Domain Number 2 Region: 34-146
Classification Level Classification E-value
Superfamily Immunoglobulin 5.47e-23
Family V set domains (antibody variable domain-like) 0.00034
Further Details:      
 
Domain Number 3 Region: 162-230
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000146
Family C1 set domains (antibody constant domain-like) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014219   Gene: ENSGGOG00000003619   Transcript: ENSGGOT00000014629
Sequence length 513
Comment pep:known_by_projection chromosome:gorGor3.1:6:27323028:27335738:1 gene:ENSGGOG00000003619 transcript:ENSGGOT00000014629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESAAALHFSRQASLLLLLLLLLLSLCALVSAQFIVVGPANPILATVGENTTLRCHLSPE
KNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEGYRGRTTFVSKDISRGSVALVIHNVT
AQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLIEMRGHEDGGIRLECISRGWYPKPLT
VWRDPYGGVVPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLPGQKKESVIFI
PESFMPSVSPCAVALPIIVVILMIPIAICIYWINKLQKEKKILSGEKEFERETREIAEKL
QEELRWRRTFLHAVDVVLDPDTAHPDLFLSEDRRSVRRCPFRHLGESVPDNPERFDSQPC
VLGRENFTSGKHYWEVEVENVIEWTVGVCRDSVERKGEVLLIPQNGFWTLEMHKGQYRAV
SSPDRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFSVPVRPFLRLGCED
SPIFICPALTGANGVTVPEEGLTLHRVGTHQSL
Download sequence
Identical sequences ENSGGOP00000014219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]