SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014226 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014226
Domain Number 1 Region: 336-523
Classification Level Classification E-value
Superfamily Fibronectin type III 2.42e-17
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 544-736
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 227-324
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000396
Family Fibronectin type III 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014226
Domain Number - Region: 150-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0383
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014226   Gene: ENSGGOG00000014580   Transcript: ENSGGOT00000014636
Sequence length 982
Comment pep:known_by_projection chromosome:gorGor3.1:17:54739980:54829769:-1 gene:ENSGGOG00000014580 transcript:ENSGGOT00000014636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFAIFQTTSFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSVVDD
AKFPEPNFWSNWSSWEEVSVQDSFGPGILFVFPKDKLVEEGSNVTICYVSRNIQNNVSCY
LEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEDIKGIVLFVSKVLEEP
KDFSCEAEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
DSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSMRN
NFTYLCQIELHGEGKMMQQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWS
GQNFTTLEAAPSEAPDVWRIVSLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPS
SSELHSIPAPANSTKLILDRCSYQICVIANNSVGASPASVIVISADPENKEVEEERIAGT
EGGFSLSWKPQPGDVIGYVVDWCDHTQDVLSGFQWKNVGPNTTSTVISTDAFRPGVRYDF
RIYGLSTKRIACLLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQG
YHVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFITPFTS
AGEGPSATFTKVTTPDEHSSMLIHILLPMVFCVLLIMVMCYLKSQWIKETCYPDIPDPYK
SSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLY
LLPTEKNHSGSGPVPCICFENLTYNQAASDSASCGHVPVSPKAPSMLGLMTSPENVLKAL
EKNYMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEPPHSSEYKMQMAVSLHLAL
PPPTENSSLSSITLLDPGERYC
Download sequence
Identical sequences XP_018869043.1.27298 ENSGGOP00000014226 ENSGGOP00000014226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]