SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014245 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014245
Domain Number 1 Region: 33-498
Classification Level Classification E-value
Superfamily Sema domain 9.81e-168
Family Sema domain 0.00000000145
Further Details:      
 
Domain Number 2 Region: 500-548
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000249
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 559-631
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000719
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014245   Gene: ENSGGOG00000014601   Transcript: ENSGGOT00000014655
Sequence length 833
Comment pep:known_by_projection chromosome:gorGor3.1:2a:94371378:94379561:-1 gene:ENSGGOG00000014601 transcript:ENSGGOT00000014655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTE
PTGLLYVGAREALFAFSMEALELQGVISWEAPVEKKTECIQKGKNNQTECFNFIRFLQPY
NASHLYVCGTYAFQPKCTYVNMLTFTLERGEFEDGKGKCPYDPAKGHAGLLVDGELYSAT
LNNFLGTEPIILRNMGPHHSMKTEYLAFWLNEPHFVGSAYVPESVGSFTGDDDKVYFFFR
ERAVESDCYAEQVVARVARVCKGDMGGARTLQKKWTTFLKARLACSAPNWQLYFNQLQAM
HTLQDTSWHNTTFFGVFQAQWGDMYLSAICEYQLEEIQRVFEGPYKEYHEEAQKWDRYTD
PVPSPRPGSCINNWHRRHGYTSSLELPDNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNF
THLVADRVTGLDGATYTVLFIGTGDGWLLKAVSLGPWVHLIEELQLFDQEPMRSLVLSQS
KKLLFAGSRSQLVQLPVADCMKYRSCADCVLARDPYCAWSVNTSRCVAVRGHSGSLLIQH
VMTSDTSGICNLRGSKKVRPTPKNITVVVGTDLVLPCHLSSNLAHARWTFGGRDLPAEQP
GSFLYDARLQALVVMAAQPRHAGAYHCFSEEQGARLAAEGYLVAVVAGPSVTLEARAPLE
NLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKATERTLVYPLELPKEPTSPPF
RPCPEPDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGG
GRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV
Download sequence
Identical sequences G3RF86
XP_018876355.1.27298 ENSGGOP00000014245 ENSGGOP00000014245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]