SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014430 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014430
Domain Number 1 Region: 607-813
Classification Level Classification E-value
Superfamily Fibronectin type III 1.81e-32
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 2 Region: 801-917
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-25
Family Fibronectin type III 0.00065
Further Details:      
 
Domain Number 3 Region: 321-413
Classification Level Classification E-value
Superfamily Immunoglobulin 3.34e-20
Family I set domains 0.0000345
Further Details:      
 
Domain Number 4 Region: 236-329
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-18
Family I set domains 0.00011
Further Details:      
 
Domain Number 5 Region: 428-507
Classification Level Classification E-value
Superfamily Immunoglobulin 4.8e-18
Family I set domains 0.0099
Further Details:      
 
Domain Number 6 Region: 511-613
Classification Level Classification E-value
Superfamily Immunoglobulin 6.97e-18
Family I set domains 0.023
Further Details:      
 
Domain Number 7 Region: 38-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000705
Family I set domains 0.00019
Further Details:      
 
Domain Number 8 Region: 138-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000358
Family I set domains 0.0000186
Further Details:      
 
Domain Number 9 Region: 907-996
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000206
Family Fibronectin type III 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014430   Gene: ENSGGOG00000014781   Transcript: ENSGGOT00000014843
Sequence length 1041
Comment pep:known_by_projection chromosome:gorGor3.1:1:185075663:185110418:1 gene:ENSGGOG00000014781 transcript:ENSGGOT00000014843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTATRRKPHLLLVAAVALVSSSAWSSALGSQTTFGPVFEDQPLSVLFPEESTEEQVLLA
CRARASPPATYWWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLASNPVGTV
VSREAILRFGFLQEFSKEERDPVKTHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTD
GRHFVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPS
IKARFPAETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSPQWTTAEPTLQIPSVSFED
EGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRW
LRNGEPLASQNRVEVLAGDLQFSKLSLEDSGMYQCVAENKHGTIYASAELAVQALAPDFR
LNPVRRLIPAARGGEIVIPCQPRSAPKAVVLWSKGTEILVNSSRVTVTPDGTLIIRNISR
SDEGKYTCFAENFMGKANSTGILSVRADATKITLAPSSADINLGDNLTLQCHASHDPTMD
LTFTWTLDDFPIDFDKPGGHYRRTNVKETIGDLTILNAQLRHGGKYTCMAQTVVDSASKE
ATVLVRGPPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTN
PANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSG
GGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTARVPGADAQYFVYSNESVR
PYTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQD
MNGILLGYEIRYWKAGDKEAAADRVRTAGLETSARVSGLHPNTKYHVTVRAYNRAGTGPA
SPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTP
TLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAP
HPGTVISHSVAMLILIGSLEL
Download sequence
Identical sequences ENSGGOP00000014430 ENSGGOP00000014430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]