SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014432 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014432
Domain Number 1 Region: 92-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000017
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014432   Gene: ENSGGOG00000014794   Transcript: ENSGGOT00000014845
Sequence length 255
Comment pep:known_by_projection chromosome:gorGor3.1:1:185118851:185119618:-1 gene:ENSGGOG00000014794 transcript:ENSGGOT00000014845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLATSFVLGSLGLAFYLPLVVTTPKTLAIPEKLQEAVGKVIINATTCTVTCGLGYKEE
TVCEVGPDGVRRKCQTQRLECLTNWICGMLHFTILIGREFELSCLSSDILEFGQEAFRFT
WRLAQGVISTDDEVFKPFQANSHFVKFKYAQEYDSGTYRCDVQLVKNLRLVKRLYFGLRV
LPPNLVHLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWKKKVASALGIGIAIGVVGGV
LVRIVLCALRGGLQQ
Download sequence
Identical sequences G3RFQ7
ENSGGOP00000014432 ENSGGOP00000014432 XP_004028288.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]