SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014467 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014467
Domain Number 1 Region: 633-1049
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.65e-95
Family alpha-mannosidase, C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 261-528
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 9.34e-85
Family alpha-mannosidase 0.012
Further Details:      
 
Domain Number 3 Region: 529-630
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 7.85e-25
Family alpha-mannosidase, domain 2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014467
Domain Number - Region: 84-132
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0298
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014467   Gene: ENSGGOG00000014818   Transcript: ENSGGOT00000014880
Sequence length 1053
Comment pep:known_by_projection chromosome:gorGor3.1:15:54969800:54982669:-1 gene:ENSGGOG00000014818 transcript:ENSGGOT00000014880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQGPSGKRSESPAMAAAPALKHWRTTLERVEKFVSPLYFTDCNLRGRLFGASCPVAVLSS
FLTPERLPYQEAVQRDFRPAQVGDSFGPTWWTCWFRVELTIPEAWVGQEVHLCWESDGEG
LVWRDGEPVQGLTKEGEKTSYVLTDRLGERDPRSLTLYVEVACNGLLGAGKGSMIAAPDP
EKMFQLSRAELAVFHRDVHMLLVDLELLLGIAKGLGKDNQRSFQALYTANQMVNVCDPAQ
PETFPVAQALASRFFGQHGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSWVTALQLM
ERNPEFIFACSQAQQLEWVKSRYPGLYSRIQEFACRGQFVPVGGTWVEMDGNLPSGEAMV
RQFLQGQNFFLQEFGKMCSEFWLPDTFGYSAQLPQIMHGCGIRRFLTQKLSWNLVNSFPH
HTFFWEGLDGSRVLVHFPPGDSYGMQGSVEEVLKTVANNRDKGRANHSAFLFGFGDGGGG
PTQTMLDRLKRLSNTDGLPRVQLSSPRQLFSALESDSEQLCTWVGELFLELHNGTYTTHA
QIKKGNRECERILHDVELLSSLALARSAQFLYPAAQLQHLWRLLLLNQFHDVVTGSCIQM
VAEEAMCHYEDIRSHGNTLLSAAAAALCAGEPGPEGLLIVNTLPWKRTEVMALPKPGGAH
SLALVTVPSMGYAPVPPPTSLQPLLPQQPVFVVQETDGSVTLDNGIIRVKLDPTGRLTSL
VLVASGREAIAEGAVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGGL
RGSAWFLLQISPNSRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSSQATYE
IQFGHLQRPTHYNTSWDWARFEVWAHRWMDLSEHGFGLALLNDCKYGASVRGSILSLSLL
RAPKAPDATADTGRHEFTYALMPHKGSFQDAGVIQAAYSLNFPLLALPAPSPAPATSWSA
FSVSSPAVVLETVKQAESSPQRRSLVLRLYEAHGSHVDCWLHLSLPVQEAILCDLLERPD
PAGHLTLRDNRLKLTFSPFQVLSLLLVLQPPPH
Download sequence
Identical sequences ENSGGOP00000014467 ENSGGOP00000014467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]