SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014531 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014531
Domain Number 1 Region: 45-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.25e-65
Family Alanine racemase-like, N-terminal domain 0.0000000513
Further Details:      
 
Domain Number 2 Region: 249-440
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.74e-29
Family Eukaryotic ODC-like 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014531   Gene: ENSGGOG00000014891   Transcript: ENSGGOT00000014944
Sequence length 480
Comment pep:known_by_projection chromosome:gorGor3.1:1:34184624:34224727:1 gene:ENSGGOG00000014891 transcript:ENSGGOT00000014944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSESDFVMVEEGFSTRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCL
PRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPASKIICANPCKQIAQ
IKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSLSRLSLKFGVSLKSCRH
LLENAKKNHAEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFP
GTEGAKVRFEEIASMINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLD
QPGREAPLPPPHIATCAACEPSPPAEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPI
LQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMVSPFGE
TQACHITYAMSRVAWEALRRQLMAAEQEDDVEGVCKPLSCSWEITDTLCVGPVFTPASIM
Download sequence
Identical sequences ENSGGOP00000014531 ENSGGOP00000014531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]