SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014599 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014599
Domain Number 1 Region: 6-122
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.15e-45
Family MHC antigen-recognition domain 0.00000242
Further Details:      
 
Domain Number 2 Region: 122-175
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000996
Family C1 set domains (antibody constant domain-like) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014599   Gene: ENSGGOG00000000700   Transcript: ENSGGOT00000015012
Sequence length 222
Comment pep:novel chromosome:gorGor3.1:6:33422163:33448510:-1 gene:ENSGGOG00000000700 transcript:ENSGGOT00000015012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGTERVRYLHRDI
YNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDVLEDERASVDTYCRHNYGVVESFTV
QRRVRPHVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTARSESA
QSKMLSGVGGFVLGLLFLGAGLFIYFKNQKGHSGLHPTGLVS
Download sequence
Identical sequences ENSGGOP00000014599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]