SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014705 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000014705
Domain Number - Region: 137-185
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.000235
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014705   Gene: ENSGGOG00000015066   Transcript: ENSGGOT00000015119
Sequence length 411
Comment pep:known_by_projection chromosome:gorGor3.1:13:74609819:75085520:1 gene:ENSGGOG00000015066 transcript:ENSGGOT00000015119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLETLIKQAENYTSILFCNTYRNMALEAAASVQEFFTDVGLYLFGADVNPEEFVNRFFDS
LFPLVYNHLINPGVTDSSLEYSECIRMARRDVSPFGNIPKRVMGQMGRSLLPSRTFLQAL
NLGIEVINTTDYLHFSKECSRALLKMQYCPHCQGLTLTKPCMGYCLNVMRGCLAHMAELN
PHWHAYIRSLEELSDAMRGTYDIEHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPV
RTPTQSPRCSFDQSKEKHGMKTTTRNSEETLANRRKEFINSLRLYRSFYGGLADQLCANE
LAAADGLPCWNGEDIVKSYTQRVVGNGIKAQSGNPEVKVKGTDPVINQIIDKLKHVIQLL
QGRSPKPDKWELLQLGSGGGMVEQVSGDCDDEDGCGGSGSGEVKRTLKITD
Download sequence
Identical sequences ENSGGOP00000014705 ENSGGOP00000014705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]