SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014706 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014706
Domain Number 1 Region: 24-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000144
Family V set domains (antibody variable domain-like) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014706   Gene: ENSGGOG00000015069   Transcript: ENSGGOT00000015121
Sequence length 311
Comment pep:known_by_projection chromosome:gorGor3.1:6:42344473:42349230:-1 gene:ENSGGOG00000015069 transcript:ENSGGOT00000015121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPNLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQ
PLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSL
NILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVL
FAVMAKRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAELPLDVPHIRLDSPPSF
DNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPA
QNPPNNQTPSS
Download sequence
Identical sequences A0A2I2YYK5
XP_003833368.1.60992 XP_004044028.1.27298 ENSGGOP00000014706 ENSGGOP00000014706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]