SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014725 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014725
Domain Number 1 Region: 237-297
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000262
Family BSTI 0.025
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014725
Domain Number - Region: 600-661
Classification Level Classification E-value
Superfamily FnI-like domain 0.00188
Family Fibronectin type I module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014725   Gene: ENSGGOG00000015088   Transcript: ENSGGOT00000015141
Sequence length 751
Comment pep:novel chromosome:gorGor3.1:12:79030332:79074044:1 gene:ENSGGOG00000015088 transcript:ENSGGOT00000015141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIIVAHIEKCSMNQNGNSLKKLAPSGRISGLCFKKLNVTTPIHKIIVNRLARKVEVDSIV
VPLPFSSQELSVEDSGSMYVITTPAGLIIKWSHLTGIIDIHFGFRFNLSSYTEGLCGICN
EDPDDDLRMQNGTIITNMEDIGLFIESWEIEKSFEVTMRRPVRNCTKHDCSQCIDLLNRR
IFIPCHDKVSPEDFCEKMWINYTYFWNYECDALSAYVALCNKFDICIQWRTPDYCSLSCP
EGKEYQPCVRPCEARTCLNQWFYGHTSCLNLREDCVCKDGTILHRPHSTQCIPEKECACT
DSEDQPRTAGEIWNGGIDECALYKCLENGSIIPIEPDCDEEPMPVCEREAEVVMGIIDKW
TCCSKEVCGCDTTLCETTIPTCTNSQKLIVGHSPLSCCPQYKCECDPLKCPSISTPECRE
DQFMIQVQQEEPCCFSPFCVCESCTKPVPLCHDGEFLTVDLNSTHFCCPQYYCVCEPNLC
PMPLLNCAEDMNLVKENVSGQCCPTWHCEKDDVCVFQEVSVLNPGQSMIKYLEEDFCYTI
ECLEEKDNHTGFHTLNFTLVNCSKKCDVHQVYTPSPSDYDCCGTCKNVSCKFHMENGTSV
VYAVGSTWHYNCTTYECVKTDEGAIILNYTMVCPPFNETECKMNEGIVKLYNEGCCKICK
REERICQKVIIKSVIRKQDCMSQSPINVASCDGKCPSATIYNINIESHLRFCKCCRENGV
RNLSVPLYCSGNGTEIMYTLQEPMDCTCQWN
Download sequence
Identical sequences ENSGGOP00000014725 ENSGGOP00000014725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]