SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014726 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014726
Domain Number 1 Region: 2-442
Classification Level Classification E-value
Superfamily Sema domain 1.31e-177
Family Sema domain 0.0000000000000503
Further Details:      
 
Domain Number 2 Region: 438-489
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000645
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 507-589
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000183
Family I set domains 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014726   Gene: ENSGGOG00000015085   Transcript: ENSGGOT00000015142
Sequence length 693
Comment pep:known_by_projection chromosome:gorGor3.1:7:81112125:81377237:-1 gene:ENSGGOG00000015085 transcript:ENSGGOT00000015142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFSFDLVKLNKQIVWPVSYTRRDECKWAGKDILKECANFIKVLKTYNQTHLYACGTGAFH
PICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRD
FAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISESDNPEDDKVYFFFRENAIDGEHSG
KATHARIGQICKNDFGGHRSLVNKWTTFLKARLICSVPGPNGIDTHFDELQDVFLMNFKD
PKNPIVYGVFTTSSNIFKGSAVCMYSMSDVRRVFLGPYAHRDGPNYQWVPYQGRVPYPRP
GTCPSKTFGGFDSTKDLPDDVITFARSHPAMYNPVFPMNNRPIVIKTDVNYQFTQIVVDR
VDAEDGQYDVMFIGTDVGTVLKVVSIPKETWYDLEEVLLEEMTVFQEPTAISAMELSTKQ
QQLYIGSTAGVAQLPLHRCDIYGKACAECCLARDPYCAWDGSACSRYFPTAKRRTRRQDI
RNGDPLTHCSDLHHDNHHGHSPEERIIYGVENSSTFLECNPKSQRALVYWQFQRRNEERK
EEIRVDDHIIRTDQGLLLRSLQQKDSGNYLCHAVEHGFIQTLLKVTLEVIDTEHLEELLH
KDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPG
HTPGNSNKWKHLQENKKGRNRRTHEFERAPRSV
Download sequence
Identical sequences ENSGGOP00000014726 ENSGGOP00000014726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]