SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014744 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014744
Domain Number 1 Region: 417-486
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000356
Family VWC domain 0.0052
Further Details:      
 
Domain Number 2 Region: 244-309
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000481
Family VWC domain 0.0081
Further Details:      
 
Domain Number 3 Region: 967-1028
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000638
Family VWC domain 0.011
Further Details:      
 
Domain Number 4 Region: 533-600
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000022
Family VWC domain 0.0084
Further Details:      
 
Domain Number 5 Region: 132-194
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000146
Family VWC domain 0.0051
Further Details:      
 
Domain Number 6 Region: 711-777
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000188
Family VWC domain 0.009
Further Details:      
 
Domain Number 7 Region: 770-836
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000146
Family VWC domain 0.0089
Further Details:      
 
Domain Number 8 Region: 362-424
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000356
Family VWC domain 0.0037
Further Details:      
 
Domain Number 9 Region: 192-251
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000795
Family VWC domain 0.024
Further Details:      
 
Domain Number 10 Region: 302-356
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000868
Family Fibronectin type I module 0.061
Further Details:      
 
Domain Number 11 Region: 829-904
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000105
Family VWC domain 0.011
Further Details:      
 
Domain Number 12 Region: 654-707
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000282
Family VWC domain 0.063
Further Details:      
 
Domain Number 13 Region: 1297-1362
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000124
Family ATI-like 0.05
Further Details:      
 
Domain Number 14 Region: 482-537
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000753
Family VWC domain 0.031
Further Details:      
 
Domain Number 15 Region: 918-963
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000366
Family VWC domain 0.0056
Further Details:      
 
Domain Number 16 Region: 88-129
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000199
Family VWC domain 0.04
Further Details:      
 
Domain Number 17 Region: 599-660
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000387
Family VWC domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014744   Gene: ENSGGOG00000015103   Transcript: ENSGGOT00000015161
Sequence length 1386
Comment pep:known_by_projection chromosome:gorGor3.1:7:127010697:127043676:-1 gene:ENSGGOG00000015103 transcript:ENSGGOT00000015161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVGAAALSLLLHLGGLALAAGTEGGAVPREPPGQQTPAHSSALAGNSQEQWHHLREWL
GRLEAAVMELREQNKDLQTRVRQLESCECHPASPQCWGLGRAWPEGARWEPDACTACVCQ
DGAAHCGPQAHLPHCRGCSQNGQTYGNGETFSPDACTTCRCLAGAMQCQGPSCSELNCLE
SCTPPGECCLICRCTEGGSHWEHGQEWTTPGDPCRICRCLEGHIQCRQRECASLCPYPAR
PLPGTCCPVCDGCFLNGREHRSGEPVGSGDPCSHCRCANGSVQCEPLPCPPVPCRHPGKI
PGQCCPVCDGCEYQGHQYQSQETFRLQERGLCVRCSCQAGEVSCEEQECPVTPCALPASG
LQLCPACELDGEEFAEGVQWEPDGRPCTACVCQDGVPECGAVLCPPAPCQHPTQPPGACC
PSCDSCTYHSQVYANGQNFTDADSPCHACHCQDGTVTCSLVDCPPTTCARPQSGPGQCCP
RCPDCILEEEVFVDGESFSHPRDPCQECRCQEGHAHCQPRACPRAPCAHPLPGTCCPNDC
SGCAFGGKEYPSGADFPHPSDPCRLCRCLSGNVQCLARRCAPLPCPEPVLLPGECCPQCP
APAGCPRPGAAPARHQEYFSPPGDPCRRCLCLDGSVSCQRLPCPPAPCAHPRQGPCCPSC
DGCLYQRKEFASGERFPSPTAACHLCLCWEGSVSCEPKACAPALCPFPARGDCCPDCDGC
EYLGESYLSNQEFPDPREPCNLCTCLGGFVTCGRRPCEPPGCSHPLIPSGHCCPTCQGCL
AHGEEHPEGSRWVPPDSACSSCVCHEGVVTCARIQCISSCAQPRQGPHDCCPQCSDCEHE
GRKYEPGESFQPGADPCEVCICEPQPEGPPSLRCHRRQCPSLVGCPPSQLLPPGPQHCCP
TCAEALSNCSEGLLGSELAPPDPCYMCQCQDLTWLCIHQACPELSCPLSERHTPPGSCCP
VCRAPTQSCVHQGREVASGERWTVDTCTSCSCMAGTVHCQSQRCSPLSCGPDKAPALSPG
SCCPRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHGGDFSVHVTNDDRGRS
GVAWTQEVAVLLGDVAVRLLQNGAVTVDGHPVALPFLREPLLYVELRGHTVILHAQPGLQ
VLWDGQSQVEVSIPGSYQGRTCGLCGNFNGFAQDDLQGPEGLLLPTDAAFGNSWQVSEGL
RPGQPCSAGQEVDPCRAAGYRARREANARCGVLKSSPFSRCHAVVPPEPFFAACVYDLCA
CGPGSSADACLCDALEAYASHCRQAGVTPTWRGPTLCVVGCPLERGFVFDECGPPCPRTC
FNQHIPLGELAAHCVRPCVPGCQCPAGLVEHEAHCIPPEACPQVLLTGDQPLGAWPSPSR
EPQETP
Download sequence
Identical sequences ENSGGOP00000014744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]