SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014825 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014825
Domain Number 1 Region: 31-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000155
Family LIM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 111-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000618
Family LIM domain 0.011
Further Details:      
 
Domain Number 3 Region: 150-186
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000685
Family LIM domain 0.0017
Further Details:      
 
Domain Number 4 Region: 4-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000245
Family LIM domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014825   Gene: ENSGGOG00000015193   Transcript: ENSGGOT00000015249
Sequence length 217
Comment pep:known_by_projection chromosome:gorGor3.1:6:44585710:44588532:-1 gene:ENSGGOG00000015193 transcript:ENSGGOT00000015249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWTCPRCEQPVFFAEKVSSLGKNWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGA
LFGPRGVNIGGVGSYLYNPPTPSPGCTTPLRPSSFSPPRPRTGLPQGKKSPPHMKTFTGE
TSLCPGCGEPVYFAEKVMSLGRNWHRPCLRCQRCHKTLTPGSHAEHDGVPYCHVPCYGYL
FGPKGGQPHPRHWDGMYMPKVWHVHGLWVCVDNFPCG
Download sequence
Identical sequences ENSGGOP00000014825 ENSGGOP00000014825 XP_018884908.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]